Lineage for d1txcb_ (1txc B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040331Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1040549Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1040550Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1040586Protein automated matches [190058] (4 species)
    not a true protein
  7. 1040594Species Pachyrhizus erosus [TaxId:109171] [186778] (2 PDB entries)
  8. 1040596Domain d1txcb_: 1txc B: [119385]
    automated match to d1icxa_
    complexed with 2an

Details for d1txcb_

PDB Entry: 1txc (more details), 2.3 Å

PDB Description: Complex crystal structure of SPE16 with ANS
PDB Compounds: (B:) pathogenesis-related class 10 protein SPE-16

SCOPe Domain Sequences for d1txcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txcb_ d.129.3.1 (B:) automated matches {Pachyrhizus erosus [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaiegyvlanpaey

SCOPe Domain Coordinates for d1txcb_:

Click to download the PDB-style file with coordinates for d1txcb_.
(The format of our PDB-style files is described here.)

Timeline for d1txcb_: