Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein automated matches [190058] (4 species) not a true protein |
Species Pachyrhizus erosus [TaxId:109171] [186778] (2 PDB entries) |
Domain d1txcb_: 1txc B: [119385] automated match to d1icxa_ complexed with 2an |
PDB Entry: 1txc (more details), 2.3 Å
SCOPe Domain Sequences for d1txcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1txcb_ d.129.3.1 (B:) automated matches {Pachyrhizus erosus [TaxId: 109171]} gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh tkgdaplsdavrddalakgagffkaiegyvlanpaey
Timeline for d1txcb_: