Lineage for d1txcb2 (1txc B:1-147)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539013Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2539076Protein automated matches [190058] (7 species)
    not a true protein
  7. 2539089Species Pachyrhizus erosus [TaxId:109171] [186778] (2 PDB entries)
  8. 2539091Domain d1txcb2: 1txc B:1-147 [119385]
    Other proteins in same PDB: d1txca3, d1txcb3
    automated match to d1icxa_
    complexed with 2an

Details for d1txcb2

PDB Entry: 1txc (more details), 2.3 Å

PDB Description: Complex crystal structure of SPE16 with ANS
PDB Compounds: (B:) pathogenesis-related class 10 protein SPE-16

SCOPe Domain Sequences for d1txcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txcb2 d.129.3.1 (B:1-147) automated matches {Pachyrhizus erosus [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaie

SCOPe Domain Coordinates for d1txcb2:

Click to download the PDB-style file with coordinates for d1txcb2.
(The format of our PDB-style files is described here.)

Timeline for d1txcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1txcb3