Lineage for d1txcb1 (1txc B:1-147)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733463Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 733491Protein Plant pathogenesis-related protein PR10 [75543] (2 species)
  7. 733492Species Jicama (Pachyrhizus erosus), SPE-16 [TaxId:109171] [143818] (2 PDB entries)
  8. 733494Domain d1txcb1: 1txc B:1-147 [119385]
    automatically matched to 1TW0 A:1-147
    complexed with 2an

Details for d1txcb1

PDB Entry: 1txc (more details), 2.3 Å

PDB Description: Complex crystal structure of SPE16 with ANS
PDB Compounds: (B:) pathogenesis-related class 10 protein SPE-16

SCOP Domain Sequences for d1txcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1txcb1 d.129.3.1 (B:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]}
gvfvfrdetsssvapaklykaltkdsdtiaqkidgpiqsielvegnggvgtikkitaneg
dktsfvlqkvdaideanlgydysivggtglpesleklsfetkvvagsgggsiskvtlkfh
tkgdaplsdavrddalakgagffkaie

SCOP Domain Coordinates for d1txcb1:

Click to download the PDB-style file with coordinates for d1txcb1.
(The format of our PDB-style files is described here.)

Timeline for d1txcb1: