Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.12: Pirin-like [101984] (3 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
Protein Hypothetical protein YhhW [141595] (1 species) |
Species Escherichia coli [TaxId:562] [141596] (1 PDB entry) Uniprot P46852 1-231 |
Domain d1tq5a1: 1tq5 A:1-231 [119311] complexed with cd |
PDB Entry: 1tq5 (more details), 1.76 Å
SCOPe Domain Sequences for d1tq5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]} miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphk dmeiltyvlegtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwim peengitpryeqrrfdavqgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaae rrvwiqvvkgnvtingvkastsdglaiwdeqaisihadsdsevllfdlppv
Timeline for d1tq5a1: