Lineage for d1tq5a1 (1tq5 A:1-231)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677575Family b.82.1.12: Pirin-like [101984] (2 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 677576Protein Hypothetical protein YhhW [141595] (1 species)
  7. 677577Species Escherichia coli [TaxId:562] [141596] (1 PDB entry)
  8. 677578Domain d1tq5a1: 1tq5 A:1-231 [119311]
    complexed with cd

Details for d1tq5a1

PDB Entry: 1tq5 (more details), 1.76 Å

PDB Description: crystal structure of yhhw from escherichia coli
PDB Compounds: (A:) Protein yhhW

SCOP Domain Sequences for d1tq5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]}
miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphk
dmeiltyvlegtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwim
peengitpryeqrrfdavqgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaae
rrvwiqvvkgnvtingvkastsdglaiwdeqaisihadsdsevllfdlppv

SCOP Domain Coordinates for d1tq5a1:

Click to download the PDB-style file with coordinates for d1tq5a1.
(The format of our PDB-style files is described here.)

Timeline for d1tq5a1: