SCOPe 2.08: Domain d1tq5a1: 1tq5 A:1-231

Lineage for d1tq5a1 (1tq5 A:1-231)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.12: Pirin-like [101984] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Hypothetical protein YhhW [141595] (1 species)

7. Species Escherichia coli [TaxId:562] [141596] (1 PDB entry)
   Uniprot P46852 1-231

8. Domain d1tq5a1: 1tq5 A:1-231 [119311]
   Other proteins in same PDB: d1tq5a2
   complexed with cd

Details for d1tq5a1

PDB Entry: 1tq5, 1.76 Å

PDB Description: crystal structure of yhhw from escherichia coli

PDB Compounds: (A:) Protein yhhW

SCOPe Domain Sequences for d1tq5a1:

Sequence; same for both SEQRES and ATOM records:

>d1tq5a1 b.82.1.12 (A:1-231) Hypothetical protein YhhW {Escherichia coli [TaxId: 562]}
miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphk
dmeiltyvlegtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwim
peengitpryeqrrfdavqgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaae
rrvwiqvvkgnvtingvkastsdglaiwdeqaisihadsdsevllfdlppv

Timeline for d1tq5a1:

• d1tq5a1 first appeared in SCOP 1.73
  
• d1tq5a1 appears in SCOPe 2.07