SCOP 1.73: Domain d1tp5a1: 1tp5 A:302-403

Lineage for d1tp5a1 (1tp5 A:302-403)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Synaptic protein PSD-95 [50162] (2 species)
   Synonym: synapse associated protein 90, sap90
   duplication: contains three PDZ domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (9 PDB entries)

8. Domain d1tp5a1: 1tp5 A:302-403 [119305]
   automatically matched to 1TP3 A:302-403

Details for d1tp5a1

PDB Entry: 1tp5, 1.54 Å

PDB Description: crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv

PDB Compounds: (A:) Presynaptic density protein 95

SCOP Domain Sequences for d1tp5a1:

Sequence; same for both SEQRES and ATOM records:

>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfean

Timeline for d1tp5a1:

• d1tp5a1 is new in SCOP 1.73
  
• d1tp5a1 appears in SCOP 1.75
  
• d1tp5a1 appears in the current release, SCOPe 2.08, called d1tp5a2