Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (6 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (46 proteins) Pfam PF00595 |
Protein Synaptic protein PSD-95 [50162] (2 species) Synonym: synapse associated protein 90, sap90 duplication: contains three PDZ domains |
Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (9 PDB entries) Uniprot P31016 62-154 |
Domain d1tp5a1: 1tp5 A:302-403 [119305] automatically matched to 1TP3 A:302-403 |
PDB Entry: 1tp5 (more details), 1.54 Å
SCOP Domain Sequences for d1tp5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfean
Timeline for d1tp5a1: