Lineage for d1tp5a1 (1tp5 A:302-403)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 797798Family b.36.1.1: PDZ domain [50157] (46 proteins)
    Pfam PF00595
  6. 797988Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 797991Species Rat (Rattus norvegicus) [TaxId:10116] [50163] (9 PDB entries)
    Uniprot P31016 62-154
  8. 797992Domain d1tp5a1: 1tp5 A:302-403 [119305]
    automatically matched to 1TP3 A:302-403

Details for d1tp5a1

PDB Entry: 1tp5 (more details), 1.54 Å

PDB Description: crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv
PDB Compounds: (A:) Presynaptic density protein 95

SCOP Domain Sequences for d1tp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfean

SCOP Domain Coordinates for d1tp5a1:

Click to download the PDB-style file with coordinates for d1tp5a1.
(The format of our PDB-style files is described here.)

Timeline for d1tp5a1: