Lineage for d1tp5a2 (1tp5 A:302-402)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786359Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)
  8. 2786360Domain d1tp5a2: 1tp5 A:302-402 [119305]
    Other proteins in same PDB: d1tp5a3, d1tp5a4
    automated match to d1be9a_

Details for d1tp5a2

PDB Entry: 1tp5 (more details), 1.54 Å

PDB Description: crystal structure of pdz3 domain of psd-95 protein complexed with a peptide ligand kketwv
PDB Compounds: (A:) Presynaptic density protein 95

SCOPe Domain Sequences for d1tp5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp5a2 b.36.1.1 (A:302-402) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea

SCOPe Domain Coordinates for d1tp5a2:

Click to download the PDB-style file with coordinates for d1tp5a2.
(The format of our PDB-style files is described here.)

Timeline for d1tp5a2: