![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein automated matches [190055] (6 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries) |
![]() | Domain d1tp5a2: 1tp5 A:302-402 [119305] Other proteins in same PDB: d1tp5a3, d1tp5a4 automated match to d1be9a_ |
PDB Entry: 1tp5 (more details), 1.54 Å
SCOPe Domain Sequences for d1tp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tp5a2 b.36.1.1 (A:302-402) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea
Timeline for d1tp5a2: