![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
![]() | Family d.17.1.2: Cystatins [54407] (7 proteins) |
![]() | Protein Cystatin C [64231] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64232] (6 PDB entries) Uniprot P01034 37-146 |
![]() | Domain d1tijb1: 1tij B:10-120 [119282] automatically matched to d1g96a_ |
PDB Entry: 1tij (more details), 3.03 Å
SCOPe Domain Sequences for d1tijb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tijb1 d.17.1.2 (B:10-120) Cystatin C {Human (Homo sapiens) [TaxId: 9606]} vggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvelg rttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda
Timeline for d1tijb1: