SCOPe 2.08: Domain d1tijb_: 1tij B:

Lineage for d1tijb_ (1tij B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin C [64231] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64232] (11 PDB entries)
   Uniprot P01034 37-146

8. Domain d1tijb_: 1tij B: [119282]
   automated match to d1g96a_

Details for d1tijb_

PDB Entry: 1tij, 3.03 Å

PDB Description: 3D Domain-swapped human cystatin C with amyloid-like intermolecular beta-sheets

PDB Compounds: (B:) Cystatin C

SCOPe Domain Sequences for d1tijb_:

Sequence; same for both SEQRES and ATOM records:

>d1tijb_ d.17.1.2 (B:) Cystatin C {Human (Homo sapiens) [TaxId: 9606]}
lvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqivagvnyfldvel
grttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

Timeline for d1tijb_:

• d1tijb_ first appeared in SCOP 1.73, called d1tijb1
  
• d1tijb_ appears in SCOPe 2.07