Lineage for d1t3xa_ (1t3x A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215401Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1215402Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 1215516Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 1215568Protein automated matches [190045] (3 species)
    not a true protein
  7. 1215571Species Human (Homo sapiens) [TaxId:9606] [186766] (4 PDB entries)
  8. 1215575Domain d1t3xa_: 1t3x A: [119140]
    automated match to d1wnja_

Details for d1t3xa_

PDB Entry: 1t3x (more details), 2 Å

PDB Description: Three Crystal Structures of Human Coactosin-like Protein
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1t3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3xa_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf
vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele
edfikselkk

SCOPe Domain Coordinates for d1t3xa_:

Click to download the PDB-style file with coordinates for d1t3xa_.
(The format of our PDB-style files is described here.)

Timeline for d1t3xa_: