![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein automated matches [190045] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186766] (6 PDB entries) |
![]() | Domain d1t3xa_: 1t3x A: [119140] automated match to d1wnja_ |
PDB Entry: 1t3x (more details), 2 Å
SCOPe Domain Sequences for d1t3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3xa_ d.109.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvrlfaf vrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdrkele edfikselkk
Timeline for d1t3xa_: