Lineage for d1sg4c_ (1sg4 C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (5 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [186760] (1 PDB entry)
  8. Domain d1sg4c_: 1sg4 C: [118959]
    automated match to d1xx4a_
    complexed with co8

Details for d1sg4c_

PDB Entry: 1sg4 (more details), 1.3 Å

PDB Description: Crystal structure of human mitochondrial delta3-delta2-enoyl-CoA isomerase
PDB Compounds: (C:) 3,2-trans-enoyl-CoA isomerase, mitochondrial

SCOPe Domain Sequences for d1sg4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg4c_ c.14.1.3 (C:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens) [TaxId: 9606]}
qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf
sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr
iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd
qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd
siqkslqmyl

SCOPe Domain Coordinates for d1sg4c_ are not available.

Timeline for d1sg4c_:

Domains from other chains:
(mouse over for more information)
d1sg4a1, d1sg4b_