Lineage for d1sg4c1 (1sg4 C:3-250)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690760Family c.14.1.3: Crotonase-like [52103] (13 proteins)
  6. 690824Protein Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) [52108] (4 species)
  7. 690834Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141999] (1 PDB entry)
  8. 690837Domain d1sg4c1: 1sg4 C:3-250 [118959]
    automatically matched to 1SG4 A:2-250
    complexed with co8

Details for d1sg4c1

PDB Entry: 1sg4 (more details), 1.3 Å

PDB Description: Crystal structure of human mitochondrial delta3-delta2-enoyl-CoA isomerase
PDB Compounds: (C:) 3,2-trans-enoyl-CoA isomerase, mitochondrial

SCOP Domain Sequences for d1sg4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sg4c1 c.14.1.3 (C:3-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf
sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr
iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd
qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd
siqkslqm

SCOP Domain Coordinates for d1sg4c1:

Click to download the PDB-style file with coordinates for d1sg4c1.
(The format of our PDB-style files is described here.)

Timeline for d1sg4c1: