PDB entry 1sg4

View 1sg4 on RCSB PDB site
Description: Crystal structure of human mitochondrial delta3-delta2-enoyl-CoA isomerase
Class: isomerase
Keywords: crotonase fold, ISOMERASE
Deposited on 2004-02-23, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.157
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,2-trans-enoyl-CoA isomerase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DCI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sg4a1
  • Chain 'B':
    Compound: 3,2-trans-enoyl-CoA isomerase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DCI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sg4b_
  • Chain 'C':
    Compound: 3,2-trans-enoyl-CoA isomerase, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DCI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sg4c_
  • Heterogens: CO8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg4A (A:)
    gsqrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpg
    vfsagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcd
    yriladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgi
    vdqvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfis
    kdsiqkslqmylerlkeekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg4A (A:)
    sqrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgv
    fsagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdy
    riladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgiv
    dqvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfisk
    dsiqkslqm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg4B (B:)
    gsqrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpg
    vfsagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcd
    yriladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgi
    vdqvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfis
    kdsiqkslqmylerlkeekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg4B (B:)
    qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf
    sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr
    iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd
    qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd
    siqkslqmylerlkeekg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sg4C (C:)
    gsqrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpg
    vfsagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcd
    yriladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgi
    vdqvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfis
    kdsiqkslqmylerlkeekg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg4C (C:)
    qrvlvepdagagvavmkfknppvnslslefltelvisleklendksfrgviltsdrpgvf
    sagldltemcgrspahyagywkavqelwlrlyqsnlvlvsaingacpaggclvaltcdyr
    iladnpryciglnetqlgiiapfwlkdtlentighraaeralqlgllfppaealqvgivd
    qvvpeeqvqstalsaiaqwmaipdharqltkammrkatasrlvtqrdadvqnfvsfiskd
    siqkslqmyl