SCOPe 2.08: Domain d1s9ck1: 1s9c K:164-289

Lineage for d1s9ck1 (1s9c K:164-289)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
   duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain

7. Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry)
   Uniprot P51659 326-479! Uniprot P51659 480-605
   the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ

8. Domain d1s9ck1: 1s9c K:164-289 [118909]
   automated match to d1s9ca1

Details for d1s9ck1

PDB Entry: 1s9c, 3 Å

PDB Description: crystal structure analysis of the 2-enoyl-coa hydratase 2 domain of human peroxisomal multifunctional enzyme type 2

PDB Compounds: (K:) Peroxisomal multifunctional enzyme type 2

SCOPe Domain Sequences for d1s9ck1:

Sequence; same for both SEQRES and ATOM records:

>d1s9ck1 d.38.1.4 (K:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}
avaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfs
arrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisn
ayvdla

Timeline for d1s9ck1:

• d1s9ck1 first appeared in SCOP 1.73
  
• d1s9ck1 appears in SCOPe 2.07