![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.4: MaoC-like [82636] (6 proteins) |
![]() | Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species) duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry) Uniprot P51659 326-479! Uniprot P51659 480-605 the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ |
![]() | Domain d1s9cb1: 1s9c B:164-289 [118891] automated match to d1s9ca1 |
PDB Entry: 1s9c (more details), 3 Å
SCOPe Domain Sequences for d1s9cb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9cb1 d.38.1.4 (B:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} avaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfs arrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisn ayvdla
Timeline for d1s9cb1: