PDB entry 1s9c

View 1s9c on RCSB PDB site
Description: Crystal structure analysis of the 2-enoyl-CoA hydratase 2 domain of human peroxisomal multifunctional enzyme type 2
Class: lyase
Keywords: hot-dog fold, hydratase 2 motif, multifunctional, lyase
Deposited on 2004-02-04, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.229
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9ca1, d1s9ca2
  • Chain 'B':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cb1, d1s9cb2
  • Chain 'C':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cc1, d1s9cc2
  • Chain 'D':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cd1, d1s9cd2
  • Chain 'E':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9ce1, d1s9ce2
  • Chain 'F':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cf1, d1s9cf2
  • Chain 'G':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cg1, d1s9cg2
  • Chain 'H':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9ch1, d1s9ch2
  • Chain 'I':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9ci1, d1s9ci2
  • Chain 'J':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cj1, d1s9cj2
  • Chain 'K':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9ck1, d1s9ck2
  • Chain 'L':
    Compound: Peroxisomal multifunctional enzyme type 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B4, EDH17B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51659
      • engineered (241)
    Domains in SCOPe 2.08: d1s9cl1, d1s9cl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s9cA (A:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cA (A:)
    aigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksm
    mvlhgeqylelykplpragklkceavvadvlvviimdvysysekelichnqfslflsdkv
    kvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfg
    fsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivi
    snayvdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s9cB (B:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cB (B:)
    gqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksinf
    akvlhgeqylelykplpragklkceavvadvvviimdvysyselichnqfslfsdkvkva
    vaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsa
    rrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisna
    yvdla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s9cC (C:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cC (C:)
    gfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviig
    qksmglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgsgvviimdv
    ysyselichnqfslflkrtsdkvkvavaipnrppdavltdttslnqaalyrlsgdwnplh
    idpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqt
    emwkegnrihfqtkvqetgdivisnayvdla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s9cD (D:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cD (D:)
    gaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqks
    mmlaeipnfakvlhgeqylelykplpragklkceavvadvlvviimdvysysekelichn
    qfslflkrtsdkvkvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslag
    fdkpilhglctfgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrih
    fqtkvqetgdivisnayvdla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s9cE (E:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cE (E:)
    gqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksvlh
    geqylelykplpragklkceavvadvlviimdvysysekelichnqfslflsdkvkvava
    ipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarr
    vlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayv
    dla
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s9cF (F:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cF (F:)
    agaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqk
    smmggglainfakvlhgeqylelykplpragklkceavvadvldkgsgvviimdvysyse
    kelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdttslnqaalyrlsgd
    wnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfkavkarfakpvypg
    qtlqtemwkegnrihfqtkvqetgdivisnayvdla
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s9cG (G:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cG (G:)
    gfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviig
    qksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgsgvvii
    mdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdttslnqa
    alyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfkavkar
    fakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdla
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s9cH (H:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cH (H:)
    gqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqkvlhg
    eqylelykplpragklkceavvadvldkgsgvviimdvysyselichnqfslflgkrtsd
    kvkvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglct
    fgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdi
    visnayvdla
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s9cI (I:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cI (I:)
    fagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigq
    ksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgsgvviim
    dvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdttslnqaa
    lyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfkavkarf
    akpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdla
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s9cJ (J:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cJ (J:)
    gqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksmmi
    nfakvlhgeqylelykplpragklkceavvadvldkgvviimdvysyseelichnqfslf
    lrtsdkvkvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpil
    hglctfgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvq
    etgdivisnayvdla
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s9cK (K:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cK (K:)
    igqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksak
    vlhgeqylelykplpragklkceavvadvldkgsgvviimdvysyselichnqfslflvg
    skrtsdkvkvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpi
    lhglctfgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkv
    qetgdivisnayvdla
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s9cL (L:)
    maatsgfagaigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptf
    gviigqksmmggglaeipglsinfakvlhgeqylelykplpragklkceavvadvldkgs
    gvviimdvysysekelichnqfslflvgsggfggkrtsdkvkvavaipnrppdavltdtt
    slnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfsarrvlqqfadndvsrfk
    avkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisnayvdlaptsgtsakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s9cL (L:)
    gqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksmmn
    fakvlhgeqylelykplpragklkceavvadvldkgsgvviimdvysysekelichnqfs
    lflvgsggfggkrtsdkvkvavaipnrppdavltdttslnqaalyrlsgdwnplhidppi
    lhglctfgfsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkv
    qetgdivisnayvdla