Lineage for d1s9ca1 (1s9c A:164-289)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. Species Human (Homo sapiens) [TaxId:9606] [143168] (1 PDB entry)
    Uniprot P51659 326-479! Uniprot P51659 480-605
    the structure of N-terminal, SDR domain is also known, PDB entry 1ZBQ
  8. Domain d1s9ca1: 1s9c A:164-289 [118889]

Details for d1s9ca1

PDB Entry: 1s9c (more details), 3 Å

PDB Description: Crystal structure analysis of the 2-enoyl-CoA hydratase 2 domain of human peroxisomal multifunctional enzyme type 2
PDB Compounds: (A:) Peroxisomal multifunctional enzyme type 2

SCOPe Domain Sequences for d1s9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]}
avaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfgfs
arrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivisn
ayvdla

SCOPe Domain Coordinates for d1s9ca1 are not available.

Timeline for d1s9ca1:

Domains from same chain:
(mouse over for more information)
d1s9ca2