![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
![]() | Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
![]() | Species Acetobacter pasteurianus [TaxId:438] [101591] (4 PDB entries) |
![]() | Domain d1ryye1: 1ryy E:435-666 [118829] Other proteins in same PDB: d1ryya2, d1ryyb2, d1ryyc2, d1ryyd2, d1ryye2, d1ryyf2, d1ryyg2, d1ryyh2 automated match to d2b9va1 mutant |
PDB Entry: 1ryy (more details), 2.8 Å
SCOPe Domain Sequences for d1ryye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ryye1 b.18.1.13 (E:435-666) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} psvcesnctggltplyladghglsfthpaadgadsyvsdpahpvpfisrpfafaqssrwk pwlvqdqreaesrpdvvtyetevldepvrvsgvpvadlfaatsgtdsdwvvklidvqpam tpddpkmggyelpvsmdifrgryrkdfakpealqpdatlhyhftlpavnhvfakghrimv qiqsswfplydrnpqkfvpnifdakpadytvatqsihhggkeatsillpvvk
Timeline for d1ryye1: