Lineage for d1ryyd2 (1ryy D:50-434)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135462Family c.69.1.21: PepX catalytic domain-like [69581] (4 protein domains)
  6. 2135463Protein Alpha-amino acid ester hydrolase [89769] (2 species)
  7. 2135464Species Acetobacter pasteurianus [TaxId:438] [102619] (4 PDB entries)
  8. 2135488Domain d1ryyd2: 1ryy D:50-434 [118828]
    Other proteins in same PDB: d1ryya1, d1ryyb1, d1ryyc1, d1ryyd1, d1ryye1, d1ryyf1, d1ryyg1, d1ryyh1
    automated match to d1nx9a2
    mutant

Details for d1ryyd2

PDB Entry: 1ryy (more details), 2.8 Å

PDB Description: Acetobacter turbidans alpha-amino acid ester hydrolase Y206A mutant
PDB Compounds: (D:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1ryyd2:

Sequence, based on SEQRES records: (download)

>d1ryyd2 c.69.1.21 (D:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvhmptdqqrdyikrevmvpmrdgvklytvivipknarnapilltr
tpynakgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgp
lnptktdettdawdtvdwlvhnvpesngrvgmtgssaegftvvmalldphpalkvaapes
pmvdgwmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfat
qagldqypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihaw
qalkdadvkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpg
sasvhlpdaiiyntgdqkwdyyrsw

Sequence, based on observed residues (ATOM records): (download)

>d1ryyd2 c.69.1.21 (D:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]}
hdplsvqtgsdipasvqqrdyikrevmvpmrdgvklytvivipknarnapilltrtpyna
kgranrvpnaltmrevlpqgddvfveggyirvfqdirgkygsqgdyvmtrpphgplnptk
tdettdawdtvdwlvhnvpesngrvgmtgssaegftvvmalldphpalkvaapespmvdg
wmgddwfhygafrqgafdyfvsqmtargggndiprrdaddytnflkagsagsfatqagld
qypfwqrmhahpaydafwqgqaldkilaqrkptvpmlweqglwdqedmwgaihawqalkd
advkapntlvmgpwrhsgvnyngstlgplefegdtahqyrrdvfrpffdeylkpgsasvh
lpdaiiyntgdqkwdyyrsw

SCOPe Domain Coordinates for d1ryyd2:

Click to download the PDB-style file with coordinates for d1ryyd2.
(The format of our PDB-style files is described here.)

Timeline for d1ryyd2: