SCOPe 2.08: Domain d1ryea1: 1rye A:30-160,A:323-381

Lineage for d1ryea1 (1rye A:30-160,A:323-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)

8. Domain d1ryea1: 1rye A:30-160,A:323-381 [118805]
   Other proteins in same PDB: d1ryea2, d1ryeb2, d1ryec2, d1ryed2
   automatically matched to d1evja1
   complexed with bme, gol, ndp
   has additional insertions and/or extensions that are not grouped together

Details for d1ryea1

PDB Entry: 1rye, 2.3 Å

PDB Description: Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis

PDB Compounds: (A:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1ryea1:

Sequence; same for both SEQRES and ATOM records:

>d1ryea1 c.2.1.3 (A:30-160,A:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
rrfgyaivglgkyalnqilpgfagcqhsriealvsgnaekakivaaeygvdprkiydysn
fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
kklmigyrchyXnqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn
tdwgyvrqggy

Timeline for d1ryea1:

• d1ryea1 first appeared in SCOP 1.73
  
• d1ryea1 appears in SCOPe 2.07