PDB entry 1rye

View 1rye on RCSB PDB site
Description: Crystal Structure of the Shifted Form of the Glucose-Fructose Oxidoreductase from Zymomonas mobilis
Class: Oxidoreductase
Keywords: Glucose, Fructose, Oxidoreductase Shifted form, NADP, Zymomonas mobilis, Oxidoreductase
Deposited on 2003-12-22, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryea1, d1ryea2
  • Chain 'B':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryeb1, d1ryeb2
  • Chain 'C':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryec1, d1ryec2
  • Chain 'D':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryed1, d1ryed2
  • Heterogens: NDP, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryeA (A:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryeA (A:)
    mpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnaekakivaaeygvdprkiy
    dysnfdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaa
    kaankklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrel
    agggslmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgals
    hgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtppannqfsaqldhlaeavin
    nkpvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ryeB (B:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryeB (B:)
    atlpagasqvpttpagrpmpyairrfgyaivglgkyalnqilpgfagcqhsriealvsgn
    aekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvm
    cekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdn
    sdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderf
    vevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtp
    ghanqsmmmpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvn
    tdwgyvrqggy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ryeC (C:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryeC (C:)
    rrfgyaivglgkyalnqilpgfagcqhsriealvsgnaekakivaaeygvdprkiydysn
    fdkiakdpkidavyiilpnslhaefairafkagkhvmcekpmatsvadcqrmidaakaan
    kklmigyrchydpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelaggg
    slmdigiyglngtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgas
    systtttsrfsvqgdkavllmdpatgyyqnlisvqtppannqfsaqldhlaeavinnkpv
    rspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ryeD (D:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryeD (D:)
    atlpagasqvpttpagrpmpyairrfgyaivglgkyalnqilpgfagcqhsriealvsgn
    aekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvm
    cekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdn
    sdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderf
    vevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtp
    ghanqsmmpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrpvnt
    dwgyvrqggy