Lineage for d1rxtc2 (1rxt C:219-455)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209616Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2209617Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 2209627Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry)
    Uniprot P30419 155-294! Uniprot P30419 295-496
  8. 2209633Domain d1rxtc2: 1rxt C:219-455 [118798]
    automated match to d3iu1a2
    complexed with co, so4

Details for d1rxtc2

PDB Entry: 1rxt (more details), 3 Å

PDB Description: Crystal structure of human myristoyl-CoA:protein N-myristoyltransferase.
PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d1rxtc2:

Sequence, based on SEQRES records: (download)

>d1rxtc2 d.108.1.2 (C:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvgivlq

Sequence, based on observed residues (ATOM records): (download)

>d1rxtc2 d.108.1.2 (C:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnthkslk
aaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyy
lynwkcpsmgaekvgivlq

SCOPe Domain Coordinates for d1rxtc2:

Click to download the PDB-style file with coordinates for d1rxtc2.
(The format of our PDB-style files is described here.)

Timeline for d1rxtc2: