SCOPe 2.08: Domain d1rxtc2: 1rxt C:219-455

Lineage for d1rxtc2 (1rxt C:219-455)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143710] (1 PDB entry)
   Uniprot P30419 155-294! Uniprot P30419 295-496

8. Domain d1rxtc2: 1rxt C:219-455 [118798]
   automated match to d3iu1a2
   complexed with co, so4

Details for d1rxtc2

PDB Entry: 1rxt, 3 Å

PDB Description: Crystal structure of human myristoyl-CoA:protein N-myristoyltransferase.

PDB Compounds: (C:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d1rxtc2:

Sequence, based on SEQRES records:

>d1rxtc2 d.108.1.2 (C:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks
lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq
yylynwkcpsmgaekvgivlq

Sequence, based on observed residues (ATOM records):

>d1rxtc2 d.108.1.2 (C:219-455) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}
ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr
ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnthkslk
aaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyy
lynwkcpsmgaekvgivlq

Timeline for d1rxtc2:

• d1rxtc2 first appeared in SCOP 1.73
  
• d1rxtc2 appears in SCOPe 2.07