Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Escherichia coli, different sequences [TaxId:562] [56938] (17 PDB entries) |
Domain d1opfe_: 1opf E: [118576] duplicate of 1OPF |
PDB Entry: 1opf (more details), 3.2 Å
SCOPe Domain Sequences for d1opfe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opfe_ f.4.3.1 (E:) Porin {Escherichia coli, different sequences [TaxId: 562]} aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
Timeline for d1opfe_: