SCOP 1.73: Domain d1opfe_: 1opf E:

Lineage for d1opfe_ (1opf E:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (1 protein)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (13 PDB entries)

8. Domain d1opfe_: 1opf E: [118576]
   duplicate of 1OPF

Details for d1opfe_

PDB Entry: 1opf, 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form

PDB Compounds: (E:) matrix porin outer membrane protein f

SCOP Domain Sequences for d1opfe_:

Sequence; same for both SEQRES and ATOM records:

>d1opfe_ f.4.3.1 (E:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d1opfe_:

• d1opfe_ is new in SCOP 1.73
  
• d1opfe_ appears in SCOP 1.75
  
• d1opfe_ appears in the current release, SCOPe 2.08