Lineage for d1opfd_ (1opf D:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1236764Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1236826Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 1236827Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 1236828Protein Porin [56937] (5 species)
  7. 1236831Species Escherichia coli, different sequences [TaxId:562] [56938] (17 PDB entries)
  8. 1236849Domain d1opfd_: 1opf D: [118575]
    duplicate of 1OPF

Details for d1opfd_

PDB Entry: 1opf (more details), 3.2 Å

PDB Description: the structure of ompf porin in a tetragonal crystal form
PDB Compounds: (D:) matrix porin outer membrane protein f

SCOPe Domain Sequences for d1opfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opfd_ f.4.3.1 (D:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

SCOPe Domain Coordinates for d1opfd_:

Click to download the PDB-style file with coordinates for d1opfd_.
(The format of our PDB-style files is described here.)

Timeline for d1opfd_: