Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.1: Muconalactone isomerase, MLI [54910] (1 protein) decamer: pentamer of dimers automatically mapped to Pfam PF02426 |
Protein Muconalactone isomerase, MLI [54911] (1 species) |
Species Pseudomonas putida [TaxId:303] [54912] (1 PDB entry) |
Domain d1mlib_: 1mli B: [118555] duplicate of 1MLI |
PDB Entry: 1mli (more details), 3.3 Å
SCOPe Domain Sequences for d1mlib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlib_ d.58.4.1 (B:) Muconalactone isomerase, MLI {Pseudomonas putida [TaxId: 303]} mlfhvkmtvklpvdmdpakatqlkadekelaqrlqregtwrhlwriaghyanysvfdvps vealhdtlmqlplfpymdievdglcrhpssihsddr
Timeline for d1mlib_: