![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.1: Muconalactone isomerase, MLI [54910] (1 protein) decamer: pentamer of dimers automatically mapped to Pfam PF02426 |
![]() | Protein Muconalactone isomerase, MLI [54911] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54912] (1 PDB entry) |
![]() | Domain d1mlia_: 1mli A: [39070] CA-atoms only |
PDB Entry: 1mli (more details), 3.3 Å
SCOPe Domain Sequences for d1mlia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mlia_ d.58.4.1 (A:) Muconalactone isomerase, MLI {Pseudomonas putida [TaxId: 303]} mlfhvkmtvklpvdmdpakatqlkadekelaqrlqregtwrhlwriaghyanysvfdvps vealhdtlmqlplfpymdievdglcrhpssihsddr
Timeline for d1mlia_: