Lineage for d1mlii_ (1mli I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949709Family d.58.4.1: Muconalactone isomerase, MLI [54910] (1 protein)
    decamer: pentamer of dimers
    automatically mapped to Pfam PF02426
  6. 2949710Protein Muconalactone isomerase, MLI [54911] (1 species)
  7. 2949711Species Pseudomonas putida [TaxId:303] [54912] (1 PDB entry)
  8. 2949720Domain d1mlii_: 1mli I: [118562]
    duplicate of 1MLI

Details for d1mlii_

PDB Entry: 1mli (more details), 3.3 Å

PDB Description: crystal structure of muconolactone isomerase at 3.3 angstroms resolution
PDB Compounds: (I:) muconolactone isomerase

SCOPe Domain Sequences for d1mlii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlii_ d.58.4.1 (I:) Muconalactone isomerase, MLI {Pseudomonas putida [TaxId: 303]}
mlfhvkmtvklpvdmdpakatqlkadekelaqrlqregtwrhlwriaghyanysvfdvps
vealhdtlmqlplfpymdievdglcrhpssihsddr

SCOPe Domain Coordinates for d1mlii_:

Click to download the PDB-style file with coordinates for d1mlii_.
(The format of our PDB-style files is described here.)

Timeline for d1mlii_: