Lineage for d1ldbc2 (1ldb C:163-331)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047016Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1047017Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1047018Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1047025Protein Lactate dehydrogenase [56339] (15 species)
  7. 1047029Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)
  8. 1047044Domain d1ldbc2: 1ldb C:163-331 [118526]
    Other proteins in same PDB: d1ldba1, d1ldbb1, d1ldbc1, d1ldbd1
    duplicate of 1LDB 163-331
    complexed with so4

Details for d1ldbc2

PDB Entry: 1ldb (more details), 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase
PDB Compounds: (C:) apo-l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldbc2:

Sequence, based on SEQRES records: (download)

>d1ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records): (download)

>d1ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd
aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr
ngirevieielnddeknrfhhsaatlksvlaraftr

SCOPe Domain Coordinates for d1ldbc2:

Click to download the PDB-style file with coordinates for d1ldbc2.
(The format of our PDB-style files is described here.)

Timeline for d1ldbc2: