![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein Lactate dehydrogenase [56339] (20 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries) |
![]() | Domain d1ldbc2: 1ldb C:163-331 [118526] Other proteins in same PDB: d1ldba1, d1ldbb1, d1ldbc1, d1ldbd1 duplicate of 1LDB 163-331 complexed with so4 |
PDB Entry: 1ldb (more details), 2.8 Å
SCOPe Domain Sequences for d1ldbc2:
Sequence, based on SEQRES records: (download)
>d1ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr
>d1ldbc2 d.162.1.1 (C:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr ngirevieielnddeknrfhhsaatlksvlaraftr
Timeline for d1ldbc2: