SCOPe 2.08: Domain d1ldbd2: 1ldb D:163-331

Lineage for d1ldbd2 (1ldb D:163-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [56344] (3 PDB entries)

8. Domain d1ldbd2: 1ldb D:163-331 [118528]
   Other proteins in same PDB: d1ldba1, d1ldbb1, d1ldbc1, d1ldbd1
   duplicate of 1LDB 163-331
   complexed with so4

Details for d1ldbd2

PDB Entry: 1ldb, 2.8 Å

PDB Description: structure determination and refinement of bacillus stearothermophilus lactate dehydrogenase

PDB Compounds: (D:) apo-l-lactate dehydrogenase

SCOPe Domain Sequences for d1ldbd2:

Sequence, based on SEQRES records:

>d1ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpirklveskgeea
qkdlerifvnvrdaayqiiekkgatyygiamglarvtrailhnenailtvsayldglyge
rdvyigvpavinrngirevieielnddeknrfhhsaatlksvlaraftr

Sequence, based on observed residues (ATOM records):

>d1ldbd2 d.162.1.1 (D:163-331) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
tildtarfrfllgeyfsvapqnvhayiigehgdtelpvwsqayigvmpidlerifvnvrd
aayqiiekkgatyygiamglarvtrailhnenailtvsayldglygerdvyigvpavinr
ngirevieielnddeknrfhhsaatlksvlaraftr

Timeline for d1ldbd2:

• d1ldbd2 first appeared in SCOP 1.73
  
• d1ldbd2 appears in SCOPe 2.07