Lineage for d1grld2 (1grl D:191-366)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1352778Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1352948Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 1352949Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 1352950Protein GroEL, A domain [52031] (4 species)
  7. 1352951Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. 1353071Domain d1grld2: 1grl D:191-366 [118463]
    Other proteins in same PDB: d1grla1, d1grla3, d1grlb1, d1grlb3, d1grlc1, d1grlc3, d1grld1, d1grld3, d1grle1, d1grle3, d1grlf1, d1grlf3, d1grlg1, d1grlg3
    duplicate of 1GRL 191-366

Details for d1grld2

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
PDB Compounds: (D:) groEL (hsp60 class)

SCOPe Domain Sequences for d1grld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grld2 c.8.5.1 (D:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1grld2:

Click to download the PDB-style file with coordinates for d1grld2.
(The format of our PDB-style files is described here.)

Timeline for d1grld2: