PDB entry 1grl

View 1grl on RCSB PDB site
Description: the crystal structure of the bacterial chaperonin groEL at 2.8 angstroms
Class: chaperonin
Keywords: chaperonin
Deposited on 1995-03-07, released 1995-10-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.326
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grla1, d1grla2, d1grla3
  • Chain 'B':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grlb1, d1grlb2, d1grlb3
  • Chain 'C':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grlc1, d1grlc2, d1grlc3
  • Chain 'D':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grld1, d1grld2, d1grld3
  • Chain 'E':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grle1, d1grle2, d1grle3
  • Chain 'F':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grlf1, d1grlf2, d1grlf3
  • Chain 'G':
    Compound: groEL (hsp60 class)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06139
      • conflict (12)
      • conflict (125)
      • conflict (266)
    Domains in SCOPe 2.03: d1grlg1, d1grlg2, d1grlg3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1grlA (A:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlA (A:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1grlB (B:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlB (B:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1grlC (C:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlC (C:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1grlD (D:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlD (D:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1grlE (E:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlE (E:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1grlF (F:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlF (F:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1grlG (G:)
    maakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvarei
    eledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgi
    dkavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedg
    tglqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleav
    akagkplliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtv
    iseeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdy
    dreklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvali
    rvaskladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygyna
    ateeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmgg
    mggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1grlG (G:)
    vkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareieledk
    fenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgidkavt
    vaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqd
    eldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagk
    plliiaedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseei
    gmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydrekl
    qervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalirvask
    ladlrgqnedqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaateey
    gnmidmgildptkvtrsalqyaasvaglmittecmvtd