| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) ![]() |
| Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein) |
| Protein GroEL, A domain [52031] (4 species) |
| Species Escherichia coli [TaxId:562] [52032] (16 PDB entries) |
| Domain d1grld2: 1grl D:191-366 [118463] Other proteins in same PDB: d1grla1, d1grla3, d1grlb1, d1grlb3, d1grlc1, d1grlc3, d1grld1, d1grld3, d1grle1, d1grle3, d1grlf1, d1grlf3, d1grlg1, d1grlg3 duplicate of 1GRL 191-366 mutant |
PDB Entry: 1grl (more details), 2.8 Å
SCOP Domain Sequences for d1grld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grld2 c.8.5.1 (D:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq
Timeline for d1grld2: