Lineage for d1grld2 (1grl D:191-366)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. Protein GroEL, A domain [52031] (4 species)
  7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)
  8. Domain d1grld2: 1grl D:191-366 [118463]
    Other proteins in same PDB: d1grla1, d1grla3, d1grlb1, d1grlb3, d1grlc1, d1grlc3, d1grld1, d1grld3, d1grle1, d1grle3, d1grlf1, d1grlf3, d1grlg1, d1grlg3
    duplicate of 1GRL 191-366

Details for d1grld2

PDB Entry: 1grl (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial chaperonin groel at 2.8 angstroms
PDB Compounds: (D:) groEL (hsp60 class)

SCOPe Domain Sequences for d1grld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grld2 c.8.5.1 (D:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatavvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1grld2 are not available.

Timeline for d1grld2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1grld1, d1grld3
View in 3D
Domains from other chains:
(mouse over for more information)
d1grla1, d1grla2, d1grla3, d1grlb1, d1grlb2, d1grlb3, d1grlc1, d1grlc2, d1grlc3, d1grle1, d1grle2, d1grle3, d1grlf1, d1grlf2, d1grlf3, d1grlg1, d1grlg2, d1grlg3