![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
![]() | Species Escherichia coli [TaxId:562] [47245] (11 PDB entries) |
![]() | Domain d1bcfg_: 1bcf G: [118427] duplicate of 1BCF A complexed with hem, mn |
PDB Entry: 1bcf (more details), 2.9 Å
SCOPe Domain Sequences for d1bcfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bcfg_ a.25.1.1 (G:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm ieilrdeeghidwleteldliqkmglqnylqaqireeg
Timeline for d1bcfg_: