Lineage for d1bcfk_ (1bcf K:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988620Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 1988748Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 1988839Domain d1bcfk_: 1bcf K: [118431]
    duplicate of 1BCF A
    complexed with hem, mn

Details for d1bcfk_

PDB Entry: 1bcf (more details), 2.9 Å

PDB Description: the structure of a unique, two-fold symmetric, haem-binding site
PDB Compounds: (K:) bacterioferritin

SCOPe Domain Sequences for d1bcfk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcfk_ a.25.1.1 (K:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d1bcfk_:

Click to download the PDB-style file with coordinates for d1bcfk_.
(The format of our PDB-style files is described here.)

Timeline for d1bcfk_: