![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
![]() | Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) ![]() |
![]() | Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
![]() | Protein Hypothetical protein PF0863 [118008] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries) Uniprot Q8U2H2 2-171 |
![]() | Domain d1yemb1: 1yem B:2-166 [116647] Other proteins in same PDB: d1yema2, d1yemb2 Structural genomics target complexed with pt, unx |
PDB Entry: 1yem (more details), 2.3 Å
SCOPe Domain Sequences for d1yemb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yemb1 d.63.1.2 (B:2-166) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig dfvdievisdspeeakekiwevakmlglkeedveprlylelinel
Timeline for d1yemb1: