Lineage for d1yemb1 (1yem B:2-166)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523297Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2523298Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2523312Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2523317Protein Hypothetical protein PF0863 [118008] (1 species)
  7. 2523318Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries)
    Uniprot Q8U2H2 2-171
  8. 2523322Domain d1yemb1: 1yem B:2-166 [116647]
    Other proteins in same PDB: d1yema2, d1yemb2
    Structural genomics target
    complexed with pt, unx

Details for d1yemb1

PDB Entry: 1yem (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus
PDB Compounds: (B:) Conserved hypothetical protein Pfu-838710-001

SCOPe Domain Sequences for d1yemb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yemb1 d.63.1.2 (B:2-166) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke
ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig
dfvdievisdspeeakekiwevakmlglkeedveprlylelinel

SCOPe Domain Coordinates for d1yemb1:

Click to download the PDB-style file with coordinates for d1yemb1.
(The format of our PDB-style files is described here.)

Timeline for d1yemb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yemb2