![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
![]() | Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families) ![]() |
![]() | Family d.63.1.2: CYTH domain [118007] (1 protein) Pfam 01928 |
![]() | Protein Hypothetical protein PF0863 [118008] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:186497] [118009] (1 PDB entry) |
![]() | Domain d1yemb_: 1yem B: [116647] complexed with pt, unx Structural genomics target |
PDB Entry: 1yem (more details), 2.3 Å
SCOP Domain Sequences for d1yemb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yemb_ d.63.1.2 (B:) Hypothetical protein PF0863 {Pyrococcus furiosus} seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi gdfvdievisdspeeakekiwevakmlglkeedveprlylelinel
Timeline for d1yemb_: