SCOP 1.71: Domain d1yemb_: 1yem B:

Lineage for d1yemb_ (1yem B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (2 families)

5. Family d.63.1.2: CYTH domain [118007] (1 protein)
   Pfam 01928

6. Protein Hypothetical protein PF0863 [118008] (1 species)

7. Species Pyrococcus furiosus [TaxId:186497] [118009] (1 PDB entry)

8. Domain d1yemb_: 1yem B: [116647]
   complexed with pt, unx
   Structural genomics target

Details for d1yemb_

PDB Entry: 1yem, 2.3 Å

PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus

SCOP Domain Sequences for d1yemb_:

Sequence; same for both SEQRES and ATOM records:

>d1yemb_ d.63.1.2 (B:) Hypothetical protein PF0863 {Pyrococcus furiosus}
seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
gdfvdievisdspeeakekiwevakmlglkeedveprlylelinel

Timeline for d1yemb_:

• d1yemb_ is new in SCOP 1.71
  
• d1yemb_ appears in SCOP 1.73
  
• d1yemb_ appears in the current release, SCOPe 2.08, called d1yemb1