Lineage for d1yema1 (1yem A:2-163)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956671Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2956672Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2956686Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2956691Protein Hypothetical protein PF0863 [118008] (1 species)
  7. 2956692Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries)
    Uniprot Q8U2H2 2-171
  8. 2956695Domain d1yema1: 1yem A:2-163 [116646]
    Other proteins in same PDB: d1yema2, d1yemb2
    Structural genomics target
    complexed with pt, unx

Details for d1yema1

PDB Entry: 1yem (more details), 2.3 Å

PDB Description: conserved hypothetical protein pfu-838710-001 from pyrococcus furiosus
PDB Compounds: (A:) Conserved hypothetical protein Pfu-838710-001

SCOPe Domain Sequences for d1yema1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yema1 d.63.1.2 (A:2-163) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]}
eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke
ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig
dfvdievisdspeeakekiwevakmlglkeedveprlyleli

SCOPe Domain Coordinates for d1yema1:

Click to download the PDB-style file with coordinates for d1yema1.
(The format of our PDB-style files is described here.)

Timeline for d1yema1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yema2