Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) |
Family d.63.1.2: CYTH domain [118007] (5 proteins) Pfam PF01928 |
Protein Hypothetical protein PF0863 [118008] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [118009] (2 PDB entries) Uniprot Q8U2H2 2-171 |
Domain d1yema1: 1yem A:2-163 [116646] Other proteins in same PDB: d1yema2, d1yemb2 Structural genomics target complexed with pt, unx |
PDB Entry: 1yem (more details), 2.3 Å
SCOPe Domain Sequences for d1yema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yema1 d.63.1.2 (A:2-163) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} eveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfke ildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegig dfvdievisdspeeakekiwevakmlglkeedveprlyleli
Timeline for d1yema1: