PDB entry 1yem

View 1yem on RCSB PDB site
Description: Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, UNKNOWN FUNCTION
Deposited on 2004-12-28, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Conserved hypothetical protein Pfu-838710-001
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: PF0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2H2 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1yema1, d1yema2
  • Chain 'B':
    Compound: Conserved hypothetical protein Pfu-838710-001
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: PF0863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2H2 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1yemb1, d1yemb2
  • Heterogens: PT, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yemA (A:)
    mhhhhhhgseveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnl
    kkyyltfkeildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtl
    evnrvegigdfvdievisdspeeakekiwevakmlglkeedveprlylelinelsgrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yemA (A:)
    seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
    eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
    gdfvdievisdspeeakekiwevakmlglkeedveprlyleli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yemB (B:)
    mhhhhhhgseveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnl
    kkyyltfkeildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtl
    evnrvegigdfvdievisdspeeakekiwevakmlglkeedveprlylelinelsgrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yemB (B:)
    seveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfk
    eildenneefyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegi
    gdfvdievisdspeeakekiwevakmlglkeedveprlylelinel