SCOPe 2.04: Domain d1y88a2: 1y88 A:3-127

Lineage for d1y88a2 (1y88 A:3-127)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.30: MRR-like [117638] (1 protein)
   Pfam PF04471

6. Protein Hypothetical protein AF1548, N-terminal domain [117639] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [117640] (1 PDB entry)
   SQ 28724

8. Domain d1y88a2: 1y88 A:3-127 [116561]
   Other proteins in same PDB: d1y88a1
   Structural genomics target
   complexed with cl, so4

Details for d1y88a2

PDB Entry: 1y88, 1.85 Å

PDB Description: Crystal Structure of Protein of Unknown Function AF1548

PDB Compounds: (A:) Hypothetical protein AF1548

SCOPe Domain Sequences for d1y88a2:

Sequence; same for both SEQRES and ATOM records:

>d1y88a2 c.52.1.30 (A:3-127) Hypothetical protein AF1548, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
nlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytg
lkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievll
eskgl

Timeline for d1y88a2:

• d1y88a2 first appeared in SCOP 1.71
  
• d1y88a2 appears in SCOPe 2.03
  
• d1y88a2 appears in SCOPe 2.05
  
• d1y88a2 appears in the current release, SCOPe 2.08