Lineage for d1y88a2 (1y88 A:10-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882680Family c.52.1.30: MRR-like [117638] (1 protein)
    Pfam PF04471
  6. 2882681Protein Hypothetical protein AF1548, N-terminal domain [117639] (1 species)
  7. 2882682Species Archaeoglobus fulgidus [TaxId:2234] [117640] (1 PDB entry)
    SQ 28724
  8. 2882683Domain d1y88a2: 1y88 A:10-127 [116561]
    Other proteins in same PDB: d1y88a1, d1y88a3, d1y88a4
    Structural genomics target
    complexed with cl, so4

Details for d1y88a2

PDB Entry: 1y88 (more details), 1.85 Å

PDB Description: Crystal Structure of Protein of Unknown Function AF1548
PDB Compounds: (A:) Hypothetical protein AF1548

SCOPe Domain Sequences for d1y88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y88a2 c.52.1.30 (A:10-127) Hypothetical protein AF1548, N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
mvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytglkeamyt
yarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievlleskgl

SCOPe Domain Coordinates for d1y88a2:

Click to download the PDB-style file with coordinates for d1y88a2.
(The format of our PDB-style files is described here.)

Timeline for d1y88a2: