Lineage for d1y88a2 (1y88 A:3-127)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585880Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 585881Superfamily c.52.1: Restriction endonuclease-like [52980] (30 families) (S)
  5. 586169Family c.52.1.30: MRR-like [117638] (1 protein)
    Pfam 04471
  6. 586170Protein Hypothetical protein AF1548, N-terminal domain [117639] (1 species)
  7. 586171Species Archaeoglobus fulgidus [TaxId:2234] [117640] (1 PDB entry)
  8. 586172Domain d1y88a2: 1y88 A:3-127 [116561]
    Other proteins in same PDB: d1y88a1
    Structural genomics target
    complexed with cl, so4

Details for d1y88a2

PDB Entry: 1y88 (more details), 1.85 Å

PDB Description: Crystal Structure of Protein of Unknown Function AF1548

SCOP Domain Sequences for d1y88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y88a2 c.52.1.30 (A:3-127) Hypothetical protein AF1548, N-terminal domain {Archaeoglobus fulgidus}
nlyfqghmvarlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytg
lkeamytyarfldvekhgftqpwiftntkfseeakkyagcvgikltgwsypekegievll
eskgl

SCOP Domain Coordinates for d1y88a2:

Click to download the PDB-style file with coordinates for d1y88a2.
(The format of our PDB-style files is described here.)

Timeline for d1y88a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y88a1