SCOPe 2.04: Domain d1y7ea1: 1y7e A:101-233

Lineage for d1y7ea1 (1y7e A:101-233)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family)

5. Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)

6. Protein Probable aminopeptidase ApeA [117241] (1 species)

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [117242] (1 PDB entry)
   Uniprot Q45055; BB0366

8. Domain d1y7ea1: 1y7e A:101-233 [116532]
   Other proteins in same PDB: d1y7ea2
   Structural genomics target

Details for d1y7ea1

PDB Entry: 1y7e, 3.2 Å

PDB Description: the crystal structure of aminopeptidase i from borrelia burgdorferi b31

PDB Compounds: (A:) Probable M18-family aminopeptidase 1

SCOPe Domain Sequences for d1y7ea1:

Sequence, based on SEQRES records:

>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilphldrkiqrnkksdeivegenlkiligslpietkeknkvklatlqlikekyk
ieeedfvsseiei

Sequence, based on observed residues (ATOM records):

>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilnlkiligslpietkeknkvklatlqlikekykieeedfvsseiei

Timeline for d1y7ea1:

• d1y7ea1 first appeared in SCOP 1.71
  
• d1y7ea1 appears in SCOPe 2.03
  
• d1y7ea1 appears in SCOPe 2.05
  
• d1y7ea1 appears in the current release, SCOPe 2.08