Lineage for d1y7ea1 (1y7e A:101-233)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2799068Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 2799069Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 2799110Protein Probable aminopeptidase ApeA [117241] (1 species)
  7. 2799111Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [117242] (1 PDB entry)
    Uniprot Q45055; BB0366
  8. 2799112Domain d1y7ea1: 1y7e A:101-233 [116532]
    Other proteins in same PDB: d1y7ea2
    Structural genomics target

Details for d1y7ea1

PDB Entry: 1y7e (more details), 3.2 Å

PDB Description: the crystal structure of aminopeptidase i from borrelia burgdorferi b31
PDB Compounds: (A:) Probable M18-family aminopeptidase 1

SCOPe Domain Sequences for d1y7ea1:

Sequence, based on SEQRES records: (download)

>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilphldrkiqrnkksdeivegenlkiligslpietkeknkvklatlqlikekyk
ieeedfvsseiei

Sequence, based on observed residues (ATOM records): (download)

>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp
vfvipdilnlkiligslpietkeknkvklatlqlikekykieeedfvsseiei

SCOPe Domain Coordinates for d1y7ea1:

Click to download the PDB-style file with coordinates for d1y7ea1.
(The format of our PDB-style files is described here.)

Timeline for d1y7ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y7ea2