![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) ![]() |
![]() | Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins) |
![]() | Protein Probable aminopeptidase ApeA [117241] (1 species) |
![]() | Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [117242] (1 PDB entry) Uniprot Q45055; BB0366 |
![]() | Domain d1y7ea1: 1y7e A:101-233 [116532] Other proteins in same PDB: d1y7ea2 Structural genomics target |
PDB Entry: 1y7e (more details), 3.2 Å
SCOPe Domain Sequences for d1y7ea1:
Sequence, based on SEQRES records: (download)
>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp vfvipdilphldrkiqrnkksdeivegenlkiligslpietkeknkvklatlqlikekyk ieeedfvsseiei
>d1y7ea1 b.49.3.1 (A:101-233) Probable aminopeptidase ApeA {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} ldakpspiseeneltfiktnyyggikkyqwlstplsirgvvflkngekveinigdnendp vfvipdilnlkiligslpietkeknkvklatlqlikekykieeedfvsseiei
Timeline for d1y7ea1: